PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G0446
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 331aa    MW: 37092.4 Da    PI: 6.7706
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G0446genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv +++++G+g+W++++   g+ R+ k+c++rw +yl
      Gh_D04G0446 14 KGPWTPEEDIVLVSYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding49.59.5e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Gh_D04G0446  67 RGNFTEHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-22564IPR009057Homeodomain-like
PROSITE profilePS5129423.934965IPR017930Myb domain
SuperFamilySSF466891.43E-3011108IPR009057Homeodomain-like
SMARTSM007171.5E-131363IPR001005SANT/Myb domain
PfamPF002491.8E-151461IPR001005SANT/Myb domain
CDDcd001678.96E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.45166116IPR017930Myb domain
SMARTSM007173.4E-1566114IPR001005SANT/Myb domain
PfamPF002492.4E-1467112IPR001005SANT/Myb domain
CDDcd001678.19E-1169111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDIVLVSYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIRRGNF TEHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKLH  120
GSEVYCRDGF TSSAASDQIS RGQWERKLQT DINMAKQALS DALSPEKSSD LTELKPCHGN  180
TYAKPEGYAS STENIAKLLK GWMRKNPLKP ASTNSGVTQQ SYDNRVATGV TTDSANSSEG  240
NDQRCSKPMC EGFESLFVFE SFDSSNSDDF SQSISTEASL SLQDETKPDL SPQLSLLEKW  300
LFDDAANQGK YYQLSDITLD ENPSFFLEGG I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-25141164105C-Myb DNA-Binding Domain
1msf_C2e-25141164105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.228590.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460698.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-120MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D2RY820.0A0A0D2RY82_G
STRINGPOPTR_0004s12530.11e-138(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-106myb domain protein 30